Recombinant Human Proprotein Convertase Subtilisin/Kexin Type 9 is produced by our Mammalian expression system and the target gene encoding Gln31-Gln692(Asp374Tyr,Val474Ile,Gly504Arg,Gly670Glu) is expressed with a 6His tag at the C-terminus.

Kexin Type 9蛋白；PCSK9蛋白;Proprotein Convertase Subtilisin/Kexin Type 9; Neural Apoptosis-Regulated Convertase 1; NARC-1; Proprotein Convertase 9; PC9; Subtilisin/Kexin-Like Protease PC9; PCSK9; NARC1

Human Cells

Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 20% Glycerol,pH 7.4.

QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTA RRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLER ITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDS HGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGP

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Recombinant Human Proprotein Convertase Subtilisin/Kexin Type 9/PCSK9 (D374Y) is a gain of function mutant of human PCSK9 protein. Human PCSK9 is a secretory subtilase belonging to the proteinase K subfamily. PCSK9 is synthesized as a soluble zymogen that undergoes autocatalytic intramolecular processing in the ER, the pro domain and mature chain are secreted together through noncovalent interactions. PCSK9 binds with low-density lipoprotein receptor (LDLR) and it plays a major regulatory role in cholesterol homeostasis. Inhibition of PCSK9 function by preventing PCSK9/LDLR interaction is currently being explored as a means of lowering cholesterol levels. PCSK9 also binds to apolipoprotein receptor 2 (ApoER2), and play a role in the neural development.

Q8NBP7